General Information

  • ID:  hor006518
  • Uniprot ID:  P01146
  • Protein name:  Urotensin-1
  • Gene name:  NA
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  Expressed in the spinal cord and not in the brain, intestine, liver, or kidney.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NDDPPISIDLTFHLLRNMIEMARNENQREQAGLNRKYLDEV
  • Length:  41
  • Propeptide:  MKPVPLVLLLTSVLLTTHIPLSTCRPRDLSLMNSQLDDVLLNGAGDGAMSYLVGEKLLQYLQRNLGAQKAGGVLHLPHFPTAQLHSPHEDNSLEELTEFSKRNDDPPISIDLTFHLLRNMIEMARNENQREQAGLNRKYLDEVGK
  • Signal peptide:  MKPVPLVLLLTSVLLTTHIPLS
  • Modification:  T41 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor. The non-hormonal portion of this precursor may be a urotensin binding protein, urophysin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01146-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006518_AF2.pdbhor006518_ESM.pdb

Physical Information

Mass: 558412 Formula: C208H335N63O68S2
Absent amino acids: CW Common amino acids: LN
pI: 4.51 Basic residues: 6
Polar residues: 9 Hydrophobic residues: 12
Hydrophobicity: -90.49 Boman Index: -12676
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 88.05
Instability Index: 4476.59 Extinction Coefficient cystines: 1490
Absorbance 280nm: 37.25

Literature

  • PubMed ID:  3484550
  • Title:  Cloning and sequence analysis of cDNA encoding urotensin I precursor.
  • PubMed ID:  6757895
  • Title:  Isolation and amino acid sequence of urotensin I, a vasoactive and ACTH-releasing neuropeptide, from the carp (Cyprinus carpio) urophysis.
  • PubMed ID:  6313156
  • Title:  Isolation, analysis of structure, synthesis, and biological actions of urotensin I neuropeptides.